PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa18g040790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 582aa    MW: 64065.6 Da    PI: 4.5357
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa18g040790.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS375.47.2e-1152165812374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      +++++cA+ +s++d ++a++ L +++e +s+ gdp++R+ +yf+eAL++rl+           +++ts++++++ + ++k++++++P+ kf+hl
  Csa18g040790.1 216 LKAIYDCAR-ISDSDPNEASKSLVQIRESVSELGDPTERVGFYFAEALSNRLSP----D----YSTTTSSSEEEDLIISYKTLNDACPYSKFAHL 301
                     578899**9.8999***************************************9....2....2333334568999******************* PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     taNqaIlea+e ++++Hi+Df+i qG+QWpaLlqaLa+R++g+p ++R+ g+ +p+ g   + +l +tg+rL++fA+ l+++fef + + + ++ 
  Csa18g040790.1 302 TANQAILEATEDSNKIHIVDFGIVQGIQWPALLQALATRSSGKPtQIRVSGIPAPSLGesPEPSLIATGNRLRDFAKVLDLNFEFVP-ILTPIHL 395
                     ****************************************77776**********99998999************************.799**** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     l+ +++rv+p+EalaVn++lql++ll+e+ ++ +   + L+l ksl+P+vv++ e e+++n+  F++r+ +a+ +ysa+f+sle +l+r+seer+
  Csa18g040790.1 396 LNGSSFRVDPDEALAVNFMLQLYKLLEETPTIVD---TALRLAKSLNPRVVTLGEYEVSLNRVGFAKRVKNAILFYSAVFESLEPNLGRDSEERV 487
                     **************************99999988...********************************************************** PP

            GRAS 284 kvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                      vEr+l+gr+i+ ++  e++  +rer+e++e+Wr  +e+aGF++v+ls++a++qak ll +++ s  y++ e++  +v l W+d pL+++S+Wr
  Csa18g040790.1 488 RVERVLFGRRISGLIGPEKTGiHRERMEQKEQWRVLMENAGFESVKLSNYAVSQAKILLWNYNySSLYSIVESKPGFVsLAWNDLPLLTISSWR 581
                     ******************99989****************************************9999*******99999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.528189559IPR005202Transcription factor GRAS
PfamPF035142.5E-112216581IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MAYMCTTTDS GNLMAIAQQV IKQKQQQEQQ QQQHHHHQDH QLFGINPLSL NPWPNNTSLG  60
FSLSGSAFPD LFQVTAGGDS NDPAFPFPSL DDHHHATTTG GGGFRLSDFG GGSDGAEFES  120
DEWMETLITG GGDSVAATAT DFTIYGPDPF ATYPSRLSSD LNNRVIDTSS PLPPPTLWPP  180
SSPLSIPPHE TTTTTTTATE DLETNDSDFD LEPPLLKAIY DCARISDSDP NEASKSLVQI  240
RESVSELGDP TERVGFYFAE ALSNRLSPDY STTTSSSEEE DLIISYKTLN DACPYSKFAH  300
LTANQAILEA TEDSNKIHIV DFGIVQGIQW PALLQALATR SSGKPTQIRV SGIPAPSLGE  360
SPEPSLIATG NRLRDFAKVL DLNFEFVPIL TPIHLLNGSS FRVDPDEALA VNFMLQLYKL  420
LEETPTIVDT ALRLAKSLNP RVVTLGEYEV SLNRVGFAKR VKNAILFYSA VFESLEPNLG  480
RDSEERVRVE RVLFGRRISG LIGPEKTGIH RERMEQKEQW RVLMENAGFE SVKLSNYAVS  540
QAKILLWNYN YSSLYSIVES KPGFVSLAWN DLPLLTISSW R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1522145813375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0107000.0AB010700.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MUD21.
GenBankAY0625380.0AY062538.1 Arabidopsis thaliana SCARECROW gene regulator (At5g66770; MUD21.1) mRNA, complete cds.
GenBankBT0025800.0BT002580.1 Arabidopsis thaliana SCARECROW gene regulator (At5g66770) mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010484588.10.0PREDICTED: scarecrow-like protein 4 isoform X1
RefseqXP_010484589.10.0PREDICTED: scarecrow-like protein 4 isoform X2
SwissprotQ9FL030.0SCL4_ARATH; Scarecrow-like protein 4
TrEMBLD7MLY40.0D7MLY4_ARALL; Putative uncharacterized protein (Fragment)
STRINGAT5G66770.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47862752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.10.0GRAS family protein